<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NJIH0041 NJIH0041 Nigeria 2013 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V   Y181C V108I V35T, V60I, K82R, D121Y, K122E, I135R, S162A, K173T, Q174K, D177E, V179X, G196E, T200A, I202V, Q207E, R211K, F214L, H221Y, V245Q, Q278E, T286A, E291D, V292I, I293V, P294T, E297R, S322T, G335D E204M
>NJIH0041| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKRKDSTKWRKLVDFRELNRRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
YEDFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIXI
CQYVDDLYVGSDLEIEQHRAKVEMLREHLLKWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKELCKLLRGAKALTDIVTLTREAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, I15V, G16E, Q18E, K20I, M36I, R41K, H69K, K70R, I72V, L89M  
>NJIH0041| codons 1-99
PQITLWQRPVVTVKVEGELIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Chaplin, B Distinct Pattern of Thymidine Analogue Mutations with K65R in Patients Failing Tenofovir-Based Antiretroviral Therapy. ARHR, 2017