<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NJIH0122 NJIH0122 Nigeria 2013 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70E, Y115F, M184V V75L K101E, Y181YC, G190A V108I K20R, V35T, T39K, V60I, I94IL, L109I, K122E, T139TA, K173X, Q174K, D177E, I178M, T200A, Q207E, R211K, F214L, H221Y, V245Q, E248D, D250E, S251H  
>NJIH0122| codons 1-253
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPI
FAIKKKNSTEWRKLLDFRELNKRTQDFWEVQLGLPHPAGLEKKKSVTIIDVGDAFFSVPL
DEDFRKYTAFTIPSINNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRXKNPEMVI
CQYVDDLYVASDLEIGQHRAKIEELREHLLKWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPDKEHWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, K20I, M36I, R41K, I64L, C67S, H69K, V82I, L89M  
>NJIH0122| codons 2-99
QITLWQRPLVTVKVGGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQ
ILLEISGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Chaplin, B Distinct Pattern of Thymidine Analogue Mutations with K65R in Patients Failing Tenofovir-Based Antiretroviral Therapy. ARHR, 2017