<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NJIH0125 NJIH0125 Nigeria 2013 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20I, M36I, N37D, R41K, E65D, H69K, L89M  
>NJIH0125| codons 1-99
PQITLWQRPLVTVKIEGQLIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYD
QILIDICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115YF, M184V   Y181C A98G V35T, T39K, K43E, K101KR, K122E, D123N, I135V, T139TK, S162A, K173S, D177E, V179I, I180V, T200A, Q207N, R211K, H221Y, V245Q, K277R, K281R, T286A, E291D, V292I, I293V, P294T, E312D  
>NJIH0125| codons 1-328
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLRKKKSVTVLDVGDAFFSVPL
DENFRKYTAFTIPSVNNEKPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRSQNPEIIV
CQYVDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAE

References
Author Title Citation
Chaplin, B Distinct Pattern of Thymidine Analogue Mutations with K65R in Patients Failing Tenofovir-Based Antiretroviral Therapy. ARHR, 2017