<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GV-41 GV-41.1 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ SQV 114

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L T215D     V60I, D123E, I135T, Q197L, K223KT  
>GV-41.1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGLHRTKIEELRQHLLRWGFDTPDKKHQTEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12N, R41K, I62V, H69I, I93L  
>GV-41.1| codons 1-99
PQITLWQRPLVNIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QVLIEICGIKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Venturi, G Divergent distribution of HIV-1 drug-resistant variants on and off antiretroviral therapy. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005