<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GV-33 GV-33.1 Italy 2000 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ RTV+ SQV 74

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20R, E35D, M36I, N37D, R41K, H69K, L89M  
>GV-33.1| codons 1-99
PQITLWQRPLVTVKIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R       I135V, S162A, K173T, Q174K, D177E, I178M, G196EV, T200A, E204K  
>GV-33.1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMVI
YQYMDDLYVGSDLEIEQHRAKIEKLRQHLLRWGFTTPDKKHQKEPPFLWM

References
Author Title Citation
Venturi, G Divergent distribution of HIV-1 drug-resistant variants on and off antiretroviral therapy. Antivir Ther, 2002