<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NJIH0274 NJIH0274 Nigeria 2013 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, M184V, T215Y   Y181C V108I V35T, K49KR, T69N, A98S, K101KQ, K122E, D123X, I135T, K173A, Q174K, D177E, T200A, Q207D, R211K, L228R  
>NJIH0274| codons 1-244
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSNRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLQKKKSVTILDVGDAYFSVPL
DEXFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELRDHLLKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, K20I, E35D, M36I, R41K, Q61H, H69K, K70R, I72T, L89M  
>NJIH0274| codons 1-99
PQITLWQRPLVTVRIEGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
HILIEICGKRATGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Chaplin, B Distinct Pattern of Thymidine Analogue Mutations with K65R in Patients Failing Tenofovir-Based Antiretroviral Therapy. ARHR, 2017