<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GV-29 GV-29.1 Italy 1999 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 134

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11VI I13V, K14R, L19LP, K20I, M36I, R41K, K43R, Q61H, L63P, H69K, V82VI, L89I  
>GV-29.1| codons 1-99
PQITLWQRPLITVRIGGQPIEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
HIPIEICGKKAIGTVLVGPTPINIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, M184V, T215FY       V35IT, S68G, D123E, I135V, S162A, K173T, Q174NS, D177E, T200A, Q207E S156P
>GV-29.1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGPPAIFQASMTKILEPFRTNNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFFTPDKKHQKEPPFLWM

References
Author Title Citation
Venturi, G Divergent distribution of HIV-1 drug-resistant variants on and off antiretroviral therapy. Antivir Ther, 2002