<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GV-21 GV-21.1 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC+ SQV 105

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, N37S, R41K, L63Q, I72V, T74AS  
>GV-21.1| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QIQIEICGHKAVGAVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R       K20R, T69S, K122E, I135T, K166R, D177X, F214L  
>GV-21.1| codons 1-230
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSSRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPXIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWM

References
Author Title Citation
Venturi, G Divergent distribution of HIV-1 drug-resistant variants on and off antiretroviral therapy. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005