<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GV-13 GV-13.1 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ IDV 90

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_SS, M184V, L210W, T215Y A62V     D123E, K166R, R211K  
>GV-13.1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M   L10I, N37D, R57K, L63P, A71V, I93L  
>GV-13.1| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Venturi, G Divergent distribution of HIV-1 drug-resistant variants on and off antiretroviral therapy. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005