<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GV-12 GV-12.1 Italy 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ D4T+ IDV 80

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W T215D     E44D, V106I, V118I, K122E, D123E, I135IT, Q207EK, H208HY, R211K  
>GV-12.1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREYLWKWGFDTPDKKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37D, L63P, H69N, I72V  
>GV-12.1| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGNKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Venturi, G Divergent distribution of HIV-1 drug-resistant variants on and off antiretroviral therapy. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005