<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GV-7 GV-7.1 Italy 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14KR, L19V, L38LF, I62V, L63T, T74A, V77I E21EV
>GV-7.1| codons 1-99
PQITLWQRPLVTIRIGGQVKVALLDTGADDTVLEEMNFPGRWKPKMIGGIGGFIKVRQYD
QVTIEICGHKAIGAVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62AV     K102Q, I135V, T139TK, I142L, Y144F, I178L, V179I, R211K  
>GV-7.1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNEKPGLRFQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLII
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWM

References
Author Title Citation
Venturi, G Divergent distribution of HIV-1 drug-resistant variants on and off antiretroviral therapy. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005