<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
H826 H826 Togo 2012 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I F53L L10V, I13V, K20T, E34Q, E35D, M36V, R41K, L63P, H69K, A71V, T74S, V77I, L89T  
>H826| codons 5-99
LWQRPVVTVKIGGQLTEALLDTGADDTVLQDVNLPGKWKPKIIGGIGGLIKVRQYDQIPI
EICGKKVIGSVLIGPTPVNIIGRNTLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F D67G, K219Q Y181C, G190A K101N T7A, V8I, K11T, I31L, V35T, E36A, T39K, K43E, T69N, V90I, I94L, K103KR, D121H, S162H, K173L, Q174QR, D177E, T200A, Q207E, R211K, L228H, V245Q W229R
>H826| codons 1-249
PISPIEAIPVTLKPGMDGPKVKQWPLTEEKLKALTAICKEMEEEGKISKIGPENPYNTPV
FAIKKKGSNRWRKLVDFRELNKRTQDFWEIQLGLPHPAGLNKRKSVTVLDVGDAYFSVPL
HKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQHSMTKILEPFRLRNPEIVI
CQYVDDLYVASDLEIGQHRAKIEELREHLLKWGFFTPDQKHQKEPPFHRMGYELHPDKWT
VQPIQLPEK

References
Author Title Citation
Konou, AA Alarming rates of virological failure and drug resistance in patients on long-term antiretroviral treatment in routine HIV clinics in Togo. AIDS, 2015