<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PSW_Pat35 02KR_PR05 Korea 2002 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, G16E, M36I, R41K, R57K, L63T, I72T, I93L  
>02KR_PR05| codons 10-99
IVTIKIEGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVKQYDQITIEICGH
KATGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K43E, K122E, D123S, K173R, Q174K, D177E, E194K, G196A, T200I, Q207A, R211S  
>02KR_RT05| codons 40-220
EMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAG
LKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRRKNPEIVIYQYMDDLYVGSDLKIAQHRIKIEELRAHLLSWGFTTPDK
K

References
Author Title Citation
Park, SW Genotypic resistance of antiretroviral drugs among drug-naive HIV type 1 patients with the background of long-term access-easy zidovudine therapy. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005