<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
H1420 H1420 Togo 2012 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F   V106A V179E, F227L K11T, V35T, E36A, T39K, K43E, V60I, S68G, V90I, K102Q, K122E, D123N, I135V, E138A, K173A, Q174K, D177E, I178L, T200A, I202V, Q207D, R211K, D237A, V245Q S162M
>H1420| codons 1-254
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTAICKELEEEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKQKKSATVLDVGDAYFSVPL
DENFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQMSMTKILEPFRAKNPELEI
YQYVDDLYVGSDLEIGQHRAKVEELRDHLLKWGFFTPDKKHQKEPPLLWMGYELHPAKWT
VQPIQLPEKDSWTV

References
Author Title Citation
Konou, AA Alarming rates of virological failure and drug resistance in patients on long-term antiretroviral treatment in routine HIV clinics in Togo. AIDS, 2015