<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PSW_Pat25 01KR_PR04 Korea 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, L19P, K20I, M36I, R41K, Q61X, L63S, H69K, K70R, L89I, T91A  
>01KR_PR04| codons 10-99
LVTVKIEGQPIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDHISIEICGK
RAIGTVLVGPTPVNIIGRNILAQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        Y56X, V90I, I135V, S162A, K173A, Q174K, D177E, I178M, T200A, Q207E, R211K  
>01KR_RT04| codons 40-220
EMEKEGKISKIGPENPXNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAG
LKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAI
FQASMTKILEPFRAKNPEMVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDK
K

References
Author Title Citation
Park, SW Genotypic resistance of antiretroviral drugs among drug-naive HIV type 1 patients with the background of long-term access-easy zidovudine therapy. ARHR, 2003