<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML_pt14 ML136_1 Italy 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDI 13
3 3TC+D4T+IDV 13
4 3TC+AZT+NFV+NVP 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   L10I, L19IV, L38V, R41K, I62V, L63P, A71T, V77I  
>ML136_1| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTVLEEMNVPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184I, T215Y K219Q K101KE, K103KN, Y181C, G190GA   V118I, K122E, I135T, I142V, T165I, F214L, D218DE, S251Q, V292I, I293V, E297Q  
>ML136_1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKQNPDIVI
CQYIDDLYVASDLEIGQHRTKIEELRQHLLRWGLYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDQWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEIVPLTQEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Monno, L Mutational patterns of paired blood and rectal biopsies in HIV-infected patients on HAART. J Med Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005