<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML_pt13 ML135 Italy 2002 HIV1 B Rectal None

Treatment History
Order Regimen Weeks
1 AZT+ DDI NA
2 3TC+D4T+RTV 8
3 3TC+D4T+IDV+NVP 8
4 3TC+DDI+IDV+NVP 8
5 D4T+DDI+NFV+NVP 8
6 ABC+SQV 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E Y181C, G190A   K20KR, A33AP, T39TP, V118I, I135T, D177E, F214L  
>ML135| codons 1-254
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKPLVEICPEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGLFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, V82A, L90LM F53L L10V, I15V, G16GA, M36L, L38V, P39Q, R41K, L63P, A71V, I72V  
>ML135| codons 1-99
PQITLWQRPVVTIKVAGQLKEALLDTGADDTILEELNVQGKWKPKIIGGIGGLVKVRQYD
QIPIEICGHKVVGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Monno, L Mutational patterns of paired blood and rectal biopsies in HIV-infected patients on HAART. J Med Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005