<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
351BH 351BH2014 Romania 2014 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12X, I13V, I15V, E35D, M36I, R41K, K45R, R57K, L63S, E65D, L89M  
>351BH2014| codons 1-99
PQITLWQRPVVXVKVGGQLKEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QISIDICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39A, E40D, V60I, D123E, I135L, S162Y, F171Y, K173A, Q174K, D177DE, V179I, G196K, T200A, Q207E, R211K, K238Q, V245Q, E248D, A272P, K277R, T286A, E291D, V292I, I293V, P294T, E297T, H315Y, I329V  
>351BH2014| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPYRAKNPEIII
YQYMDDLYVGSDLEIKQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDQWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVTLTTEAE
LELAENREILKEPVYGVYYDPSKDLIAEVQKQGQ

References
Author Title Citation
Paraschiv, S Epidemic dispersion of HIV and HCV in a population of co-infected Romanian injecting drug users. PLoS ONE, 2017