<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4325BH 4325BH2013 Romania 2013 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12I, I15V, K20R, E35D, M36I, R41K, R57K, I62V, L63A, L89M  
>4325BH2013| codons 1-99
PQITLWQRPVVIIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QVAIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K49R, V60I, S68G, K104R, V106I, D123E, I135T, S162H, K166Q, E169K, K173E, Q174R, D177E, I178V, I195L, T200A, Q207E, R211K, V245Q, E248D, A272P, K277R, E291D, V292I, I293V, E297A, I326V Q151Q*
>4325BH2013| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTDMEKEGKISRIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLP*GWKGSPAIFQHSMTQILKPFRERNPEVVI
YQYMDDLYVGSDLELGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQ

References
Author Title Citation
Paraschiv, S Epidemic dispersion of HIV and HCV in a population of co-infected Romanian injecting drug users. PLoS ONE, 2017