<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML_pt9 ML1030_1 Italy 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDI 8
3 3TC+AZT 8
4 3TC+D4T+SQV 8
5 3TC+D4T+IDV 8
6 ABC+D4T+DDI 8

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84IV, L90M I47IM, G73S T4S, L10I, K20R, E35D, M36I, K45R, I62V, L63P, C67F, H69N, A71V, I72IL  
>ML1030_1| codons 1-99
PQISLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPRMMGGIGGFVKVRQYD
QVPIEIFGNKVLSTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184MV, L210W, T215Y       E40X, R83K, K101Q, K104R, V118I, D123E, E203K, Q207E, H208HY, R211K, A272P, T286P, E297R, E312Q  
>ML1030_1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTXLEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLQKKRSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGPKALTEVIPLTREAE
LELAENREILKQPVHGVYYDPSKD

References
Author Title Citation
Monno, L Mutational patterns of paired blood and rectal biopsies in HIV-infected patients on HAART. J Med Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005