<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML_pt8 ML1229 Italy 2002 HIV1 B Rectal None

Treatment History
Order Regimen Weeks
1 AZT NA
2 3TC+AZT 13
3 3TC+D4T+SQV 13
4 3TC+D4T+IDV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50V   G16GR, N37S, L63LP  
>ML1229| codons 1-99
PQITLWQRPLVTIKIRGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGVGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Monno, L Mutational patterns of paired blood and rectal biopsies in HIV-infected patients on HAART. J Med Virol, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005