<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML_pt8 ML1229 Italy 2002 HIV1 B Rectal None

Treatment History
Order Regimen Weeks
1 AZT NA
2 3TC+AZT 13
3 3TC+D4T+SQV 13
4 3TC+D4T+IDV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50V   G16GR, N37S, L63LP  
>ML1229| codons 1-99
PQITLWQRPLVTIKIRGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGVGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, M184MV, T215F K219Q K101KE, G190GV A98G K103KR, S117SP, D123E, S162SG, E169EG, V179VI, G196GE, Q197QR, I202V, E203EK, R206RK, Q207QH, D218DE, E224EK, V245E R83EK, Q182QR
>ML1229| codons 1-247
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKETQDFWEVQLGIPHPGGLEKRKSVTVLDVGDAYFPVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQGSMTKILGPFRKQNPDIII
YRYVDDLYVVSDLEIERHRTKVKELKHHLLRWGFFTPEQKHQKKPPFLWMGYELHPDKWT
VQPIELP

References
Author Title Citation
Monno, L Mutational patterns of paired blood and rectal biopsies in HIV-infected patients on HAART. J Med Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005