<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML_pt7 ML128_2 Italy 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ RTV+ DDI NA
2 D4T+DDI+IDV 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M   K20R, M36I, L63P, C67Y, H69K, A71V, I72V  
>ML128_2| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTILEEINLPGRWKPKIIGGIGGFIKVRQYD
QIPIEIYGKKVVGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215SY       D123E, I178L, R211RK, V245E K82T
>ML128_2| codons 1-254
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNTRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFSTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTV

References
Author Title Citation
Monno, L Mutational patterns of paired blood and rectal biopsies in HIV-infected patients on HAART. J Med Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005