<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML_pt6 ML127_1 Italy 2002 HIV1 B Rectal None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDC 4
3 AZT+DDI 8
4 3TC+AZT+SQV 4
5 3TC+AZT+RTV 4
6 3TC+D4T+IDV 4
7 3TC+D4T+SQV 8
8 3TC+D4T+NVP 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y   K103N, Y181C   K20R, V35M, T39A, E44D, K102Q, V118I, K122E, D123E, S162A, E203K, Q207QE, H208HY, R211KN, K219X, K223KE  
>ML127_1| codons 1-251
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKQNKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKIKELREYLWKWGFYTPDXKHQEEPPFLWMGYELHPDKWT
VQPIVLPEKDS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37D, L63H G94GA, L97LS
>ML127_1| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIHIEICGHKAIGTVLVGPTPVNIIGRNLLTQIACTSNF

References
Author Title Citation
Monno, L Mutational patterns of paired blood and rectal biopsies in HIV-infected patients on HAART. J Med Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005