<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML_pt2 ML126_2 Italy 2002 HIV1 B Rectal None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+DDI 8
3 3TC+AZT 8
4 3TC+D4T+IDV 13
5 3TC+D4T+EFV 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, M184MV, L210LW, T215SY   K101KE A98G R83RK, K103KR, D123E, D177DG, T200TI, R211K, V245T D185DE
>ML126_2| codons 1-248
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKKTQDFWEVQLGIPHPGGLEKRKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYVEDLYVGSDLEIGQHRIKIEELRQHLWKWGFSTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50V   N37S  
>ML126_2| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGVGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Monno, L Mutational patterns of paired blood and rectal biopsies in HIV-infected patients on HAART. J Med Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005