<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML_Pat89 ML_Pat89 Italy 2002 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, I84V, L90M G73T L10I, I15V, G16E, L19Q, K20M, I62V, L63N, A71V, I72T, P79D, I93L  
>ML_Pat89| codons 1-99
PQITLWQRPIVTIKVEGQQMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYD
QVNIEICGHKVTTTVLVGDTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Monno, L HIV-1 phenotypic susceptibility to lopinavir(LPV) and genotypic analysis in LPV/r-naive subjects with prior protease inhibitor experience. JAIDS, 2003