<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, I84V, L90M G73T L10I, I15V, G16E, L19Q, K20M, I62V, L63N, A71V, I72T, P79D, I93L  
>ML_Pat89| codons 1-99
PQITLWQRPIVTIKVEGQQMEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYD
QVNIEICGHKVTTTVLVGDTPVNVIGRNLMTQLGCTLNF

References
Author Title Citation
Monno, L HIV-1 phenotypic susceptibility to lopinavir(LPV) and genotypic analysis in LPV/r-Naive subjects with prior protease inhibitor experience. JAIDS, 2003