<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I Q7E, L10I, E35D, M36I, R41K, Q61HN, I62V, L63P, A71V, T74S, V77I, I93L  
>ML_Pat88| codons 1-99
PQITLWERPIVTIKIGGQLKEALIDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVRQYD
QVPIEICGHKVIGSVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Monno, L HIV-1 phenotypic susceptibility to lopinavir(LPV) and genotypic analysis in LPV/r-Naive subjects with prior protease inhibitor experience. JAIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005