<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML_Pat74 ML_Pat74 Italy 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73GS L10I, T12TI, N37D, I62V, L63P, A71V, V77I, I93L  
>ML_Pat74| codons 1-99
PQITLWQRPIVIIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Monno, L HIV-1 phenotypic susceptibility to lopinavir(LPV) and genotypic analysis in LPV/r-naive subjects with prior protease inhibitor experience. JAIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005