<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ML_Pat6 ML_Pat6 Italy 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37D, L63A, I64V, V77I  
>ML_Pat6| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYD
QIAVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Monno, L HIV-1 phenotypic susceptibility to lopinavir(LPV) and genotypic analysis in LPV/r-naive subjects with prior protease inhibitor experience. JAIDS, 2003
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005