<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4125 CA40820 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 64
2 3TC+AZT+IDV 89
3 NFV+NVP+SQV 26
4 EFV+NFV+SQV 23
5 3TC+D4T+NFV+SQV 59
6 ABC+D4T+NFV+SQV 35
7 ABC+APV+D4T+RTV+SQV 87
8 ABC+APV+D4T+SQV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L10F, F53L N37D, L63C, T74S, L89M  
>CA40820| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGLVKVRQYD
QICIEICGHKAIGSVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103NS   E6DN, A98S, K122E, D123N, Q174QK, I178IV, T200IK, Q207E, R211K, V245E, T286A, E297Q  
>CA40821| codons 1-300
PISPINTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKSKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDVVI
YQYMDDLYVGSDLEIGQHRKKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTQEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005