<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1317 CA1317-5/3 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI NA
2 3TC+ AZT+ DDI NA
3 None 3
4 D4T+ DDI+ IDV 53
5 3TC+ AZT+ SQV 37
6 None 6
7 D4T+ IDV+ NVP+ RTV 16
8 3TC+ ABC+ AZT+ LPV+ SQV 77
9 3TC+ EFV+ LPV+ TDF 4
10 None 11
11 TDF+ LPV+ EFV+ 3TC 48
12 Unknown 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, Q151M, M184V A62V, K70N, V75I, F77L, F116Y K103NS, Y181C, Y188L   I31IR, E40K, K43E, K46Q, K49R, I50IV, T58N, S68G, T69TI, D121DH, K122E, P170S, Q174K, T200A, Q207E, R211K, K219T, L228H, V245T, E248D, D250E, S251D, A272P, T286A, A288S, V292I, E297K  
>CA1317-5/3| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKRKALVEICTKMEEEGQISRVGPENPYNNPV
FVIKKKDGINWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKSKSVTVLDVGDAFYSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILESFRKKNPDIVI
CQYVDDLLVGSDLEIGQHRAKIEELREHLLKWGFTTPDTKHQKEPPFHWMGYELHPDKWT
VQPITLPDKEDWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKSLTEIIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L90M L10F, N88G I13L, I15V, K20T, E35N, M36I, R41K, R57K, I62V, L63P, C67Y, A71I, I93L  
>CA1317-5/3| codons 1-99
PQITLWQRPFVTLKVGGQLTEALLDTGADDTVLENINLPGKWKPKIIGGIGGFVKVKQYD
QVPIEIYGHKIIGTVLVGPTPVNIIGRGLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012