<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VC_pat53 VC53-11 Spain 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ NVP NA
2 AZT+DDI+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67HN, K70R   G190S V108VI S162C, I167F, Q197E, E203EA, R211K, L228LR G99W, Q145K, H198HY
>VC53-11| codons 41-246
MEKEGKISKIGPENPYNTPVFAIKKKHSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAWL
KKKKSVTILDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYKYNVLPQGWKGSPAIF
QCSMTKFLEPFRKQNPDIVIYQYMDDLYVSSDLEIGEYRTKIAELRQHLLKWGFTTPDKK
HQKEPPFRWMGYELHPDKWTVQPIVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14KQ, L33V, I64V  
>VC53-11| codons 6-98
WQRPLVTIQIGGQLKEALLDTGADDTVVEEMNLPGRWKPKMIGGIGGFIKVRQYDQILVE
ICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLN

References
Author Title Citation
Vidal, C Genotypic and phenotypic resistance patterns in early-stage HIV-1-infected patients failing initial therapy with stavudine, didanosine and nevirapine. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005