<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
VC_pat20 VC20-21 Spain 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ DDI+ NVP NA
2 D4T+DDI+IDV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  V11VI K14KE, N37T, I62V, L63P, K70KR, V77I, I93L I15AT
>VC20-21| codons 5-98
LWQRPLITIEAGGQLKEALLDTGADDTVLEEMTLPGRWKPKMIGGIGGFIKVRQYDQVPI
EICGHRAIGTVLIGPTPVNIIGRNLLTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K64R, K122E, I202IV  
>VC20-21| codons 38-246
CTEMEKEGKISKIGPENPYNTPVFAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKVEELRQHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVL

References
Author Title Citation
Vidal, C Genotypic and phenotypic resistance patterns in early-stage HIV-1-infected patients failing initial therapy with stavudine, didanosine and nevirapine. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005