<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2nd_5020 2nd_5020 Tanzania 2011 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI NA
2 TDF+FTC+LPV 108

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L10F, K43T I13V, L19I, A22V, E35D, M36I, R41K, R57K, Q61N, L63P, H69K, K70R, L89I, T91S  
>2nd_5020| codons 1-99
PQITLWQRPFVTVKIGGQIKEVLLDTGADDTVLEDINLPGKWTPKIIGGIGGFVKVKQYD
NIPIEICGKRAIGTVLVGPTPANIIGRNILSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, V60I, W88C, K122E, D123S, I135T, K173S, Q174K, D177E, I178V, T200A, Q207A, R211S, F214L, V245E, D250E  
>2nd_5020| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFCEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKNPEVVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWT

References
Author Title Citation
Svard, J Drug resistance testing through remote genotyping and predicted treatment options in human immunodeficiency virus type 1 infected Tanzanian subjects failing first or second line antiretroviral therapy. PLoS ONE, 2017