<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2nd_5016 2nd_5016 Tanzania 2012 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC+EFV 381
2 TDF+FTC+LPV 57

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, K20R, E35D, M36I, R41K, K45R, R57K, L63S, H69K, K70R, L89M  
>2nd_5016| codons 1-99
PQITLWQRPVVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYD
QISIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, L210W, T215Y K219E K103S, G190A   K20R, V35T, E44D, V60I, V118I, K122E, K173S, Q174K, N175Y, D177E, V179X, T200S, K201R, I202V, Q207A, R211N, K223Q, V245Q, E248D, D250E, I257L  
>2nd_5016| codons 3-263
SPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKDGKISKIGPENPYNTPIFA
IKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKSKSVTVLDVGDAYFSIPLDE
DFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRSKYPEIXIYQ
YVDDLYVASDLEIGQHRSRVEELRAHLWNWGFYTPDEKHQQEPPFLWMGYELHPDKWTVQ
PIQLPDKESWTVNDLQKLVGK

References
Author Title Citation
Svard, J Drug resistance testing through remote genotyping and predicted treatment options in human immunodeficiency virus type 1 infected Tanzanian subjects failing first or second line antiretroviral therapy. PLoS ONE, 2017