<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
C_F_25-30_none_5 C_F_25-30_none_5 South Africa 2016 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15IV, L19T, M36L, N37A, L63T, H69K, V82I, L89M, I93L  
>C_F_25-30_none_5| codons 6-99
WQRPLVTIKVGGQTKEALLDTGADDTVLEELALPGRWKPKMIGGIGGFIKVRQYDQITIE
ICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36EA, T39D, S48T, V60I, D121H, K122E, K173T, D177E, T200A, Q207K, R211S, V245C  
>C_F_25-30_none_5| codons 1-257
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPICLPEKDSWTVNDI

References
Author Title Citation
van Zyl, GU Moderate levels of pre-therapy drug resistance (PDR) in a generalised epidemic: time for better first-line ART? AIDS, 2017