<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SHNY-13 SHNY-13 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+ RTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48M, I54S, V82A L33F L10I, I13IV, L63P, A71V, I93L  
>SHNY-13| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKLIMGIGGFSKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184MIV, L210W, T215Y K219KR K103NS K238T K20R, K43E, E44EA, V60I, V118I, E138Q, Q207E, R211K, A272P E40L
>SHNY-13| codons 1-311
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTLMEEAGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYIDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDRKHQKEPPFLWMGYELHPDTWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILK

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005