<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
WoSSVC_INT89 WoSSVC_INT89 U.K. 2016 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, V32I, I72V, L74X, T112V, I113V, T124A, T125A, V126M, G134N, K136Q, V165VI, V201I, T206S, I220V, L234I V281M, S283G, D286N
>WoSSVC_INT89| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASDFNLPPVIAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVIXVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAMKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQIRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKVQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCMAGRQNED

References
Author Title Citation
Bradley-Stewart, A HIV-1 integrase inhibitor resistance among treatment nave patients in the West of Scotland. J Clin Virol, 2017