<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TTDpci144 TTDpci144 Cote d'Ivoire 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, G16E, K20R, E35D, M36I, R41K, R57K, H69Q, L89M  
>TTDpci144| codons 1-99
PQITLWQRPIVTVKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36D, K122KE, D123N, I142V, S162A, K173A, Q174R, D177E, T200A, Q207E, P243T, V245E, K249Q  
>TTDpci144| codons 9-255
PVKLKPGMDGPKVKQWPLTEEKIKALTDICTEMEKEGKISKIGPENPYNTPVFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYT
AFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRARNPEIVIYQYMDDLY
VGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQTIELPE
QDSWTVN

References
Author Title Citation
Toni, TD Presence of key drug resistance mutations in isolates from untreated patients of Abidjan, Cote d'Ivoire: ANRS 1257 study. ARHR, 2003