<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TTDpci143 TTDpci143 Cote d'Ivoire 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35T, E36D, T39K, V60I, K102Q, V118I, K122E, I135V, Q145QH, S162A, T165I, F171Y, K173T, Q174K, D177E, I178M, T200A, Q207E, F214L, V245Q, K249N K30KE
>TTDpci143| codons 11-255
KLKPGMDGPKIKQWPLTEEEIKALTDICKEMEKEGKISKIGPENPYNTPIFAIKKKDSTK
WRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSIPLDEDFRKYTAF
TIPSVNNETPGIRYHYNVLPQGWKGSPAIFQASMIKILEPYRTKNPEMVIYQYMDDLYVG
SDLEIGQHRAKIEELREHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPEND
SWTVN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K20I, M36I, R57K, I66IV, H69K, L89M  
>TTDpci143| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVKQYD
QILIEVCGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Toni, TD Presence of key drug resistance mutations in isolates from untreated patients of Abidjan, Cote d'Ivoire: ANRS 1257 study. ARHR, 2003