<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRP2096 BRP2096 Brazil 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, L19I, M36I, N37K, R41N, H69K, L89M  
>BRP2096| codons 1-99
PQITLWQRPLVTVKVGGQIKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39D, S48T, V60I, K122E, D123G, I135T, S162A, Q174H, R211K, F214L  
>BRP2096| codons 37-225
ICDEMEKEGKITKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGS
PAIFQASMTKILEPFRKHNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTT
PDKKHQKEP

References
Author Title Citation
Brindeiro, RM Brazilian network for HIV drug resistance surveillance (HIV-BResNet): A survey of chronically infected individuals. AIDS, 2003