<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRP2100 BRP2100 Brazil 2001 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I15V, G16E, E21G, M36I, N37K, R41N, H69K, I93L  
>BRP2100| codons 1-99
PQITLWQRPIVTIKVEGQLKGALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Brindeiro, RM Brazilian network for HIV drug resistance surveillance (HIV-BResNet): a survey of chronically infected individuals. AIDS, 2003