<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2527u 2527u Denmark 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, I15V, Q18I, L19P, K20T, L63P, A71I, T74S, I93L  
>2527u| codons 2-99
QITLWQRPLVTVKVGGIPTEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQ
IPIEICGHKIIGSVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Banke, S Positive selection pressure introduces secondary mutations at Gag cleavage sites in human immunodeficiency virus type 1 harboring major protease resistance mutations. J Virol, 2009