<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2725u 2725u Denmark 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I50IL, L90M G73T L10I, L19I, K20R, N37H, L63P, I64V, I72L, V77I, I93L  
>2725u| codons 2-99
QITLWQRPIVTIKIGGQIREALLDTGADDTVLEEMHLPGRWKPKIIGGLGGFIKVRQYDQ
IPVEICGHKALTTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Banke, S Positive selection pressure introduces secondary mutations at Gag cleavage sites in human immunodeficiency virus type 1 harboring major protease resistance mutations. J Virol, 2009