<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T128002 T128002 France 2007 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA
2 RAL+ETR+DRV+RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, N88S, L90M L33F L10V, I13IV, K14R, I15V, K20T, E35D, M36I, R41K, K45R, R57K, Q61N, L63V, A71I, I72V, V77I, L89I, Q92K, I93L  
>T128002| codons 4-99
TLWQRPVVTVRVGGQLTEALLDTGADDTVFEDINLPGKWKPRMIGGIGGFVKVKQYDNIV
IEICGHKIVGTVLIGPTPVNIIGRSIMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y V75S, K219KN L100I V179D T39A, K43E, K73M, K103R, K122X, D123T, I135T, S162C, E169D, Q174K, D177E, Q207E, R211K, H221HY  
>T128002| codons 38-239
CAELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRMVSDFRELNKRTQDFWEVQLGIPHP
AGIKKRKSVTVLDVGDAYFSVPLDXTFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILDPFRKKNPEIDIYQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTP
DNKYQKEPPFLWMGYELHPDKW

References
Author Title Citation
Charpentier, C Resistance analyses in highly experienced patients failing raltegravir, etravirine and darunavir/ritonavir regimen. AIDS, 2010