<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T085002 T085002 France 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA
2 RAL+ETR+DRV+RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M L33F, G73T L10V, I13V, N37ND, K55R, L63P, I66V, V77I, I93L, C95F  
>T085002| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVFEEMDLPGRWKPKIIGGIGGFVRVRQYD
QIPIEVCGHKAITTVLIGPTPANIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y K219N K101P   V35M, T39A, K43X, E44D, V60I, V118I, D123E, V179I, G196E, T200K, Q207D, R211K  
>T085002| codons 33-237
ALMEICAELEXDGKISKIGPENPYNTPIFAIKKKNSDKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLPKKKSVTVLDVGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQG
WKGSPAIFQSSMTKILEPFRKQNPDIIIYQYVDDLYVGSDLEIEQHRKKIEELRDHLWKW
GFYTPDNKHQKEPPFLWMGYELHPD

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    L101I, I113V, T125A, M154L, V176L, V201I, T206S, I208L  
>T085002| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTVHTDNGSN
FTSTAVKAACWWAGIKQEFGIPYNPQSQGVVESLNKELKKIIGQVRDQAEHLKTALQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDLQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Charpentier, C Resistance analyses in highly experienced patients failing raltegravir, etravirine and darunavir/ritonavir regimen. AIDS, 2010