<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
T062009 T062009 France 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA
2 RAL+ETR+DRV+RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82F L10F, V11VI, L33F, Q58E I13V, E35D, M36I, R57K, L63P, E65ED, A71V, V77I, L89M, I93L D60T
>T062009| codons 1-99
PQITLWQRPFITVKIGGQLKEALLDTGADDTVFEDINLPGRWKPKLIGGIGGFVKVKEYT
QIPIDICGHKVIGTVLIGPTPFNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W       T39A, E44D, L74X, V118I, K122E, D123DN, V179I, G196E, E203K, Q207E, H208Y, R211K, T215X, K223E, E224EK  
>T062009| codons 33-239
ALVEICAELEKDGKISKIGPENPYNTPVFAIKKKNSDKWRKXVDFRELNKRTQDFWEVQL
GIPHPAGLKKKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQG
WKGSPAIFQSSMTKILEPFRKQNPDIIIYQYVDDLYVGSDLEIEQHRTKIKELREYLWKW
GFXTPDKKHQEKPPFLWMGYELHPDKW

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, R20K, V31I, S39C, L101I, K111T, T122I, Q177X, V201I, Q216H Q252QR, S283G
>T062009| codons 1-288
FLDGIDKAQEDHEKYHSNWKAMASDFNLPPIVAKEIVACCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVTTIHTDNGSN
FISTTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVXMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKHITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIRDNSDIKVVPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Charpentier, C Resistance analyses in highly experienced patients failing raltegravir, etravirine and darunavir/ritonavir regimen. AIDS, 2010