<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BRNE265 BRNE265 Brazil 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, T12S, I15V, M36L, R41K, I62V, L63C, A71T, C95S  
>BRNE265| codons 1-99
PQITLWQRPVVSIKVGGQLKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYD
QVCIEICGHKTIGTVLVGPTPVNIIGRNLLTQIGSTLNF

References
Author Title Citation
Brindeiro, RM Brazilian network for HIV drug resistance surveillance (HIV-BResNet): a survey of chronically infected individuals. AIDS, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005