<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2011-026 2011-026 Puerto Rico 2011 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, K20R, E35D, M36I, R41K, L63AITV, G68E, H69K, K70R, V82VI, L89M, T91V, I93L  
>2011-026| codons 14-99
KIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIVIEICEKRAIG
TVLVGPTPINIIGRNMLVQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        L34T, V35L, E36N, I37F, T39K, E40ED, D121Y, K122E, I135T, I142IV, T165TI, D177E, T200A, E204ED, Q207HN, R211KT, F214L G141G*W, P157PS
>2011-026| codons 34-225
TLNFCKDMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLG
IPHPAGLKKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSTNNETPWVRYQYNVLPQGW
KGSSAIFQSSMIKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEDLRNHLLTWG
LTTPDKKHQKEP

References
Author Title Citation
Lopez, P The genetic diversity and evolution of HIV-1 subtype B epidemic in Puerto Rico. Unpublished, 2016