<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2011-026 2011-026 Puerto Rico 2011 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, K20R, E35D, M36I, R41K, L63X, G68E, H69K, K70R, V82VI, L89M, T91V, I93L  
>2011-026| codons 14-99
KIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIXIEICEKRAIG
TVLVGPTPINIIGRNMLVQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K30Q, I31L, K32G, A33C, L34T, V35L, E36N, I37F, T39K, E40ED, D121Y, K122E, I135T, G141X, I142IV, T165TI, D177E, T200A, E204ED, Q207X, R211X, F214L P157PS
>2011-026| codons 30-225
QLGCTLNFCKDMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSTNNETPXVRYQYNVL
PQGWKGSSAIFQSSMIKILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEDLRXHL
LXWGLTTPDKKHQKEP

References
Author Title Citation
Lopez, P The genetic diversity and evolution of HIV-1 subtype B epidemic in Puerto Rico. Unpublished, 2016