<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2001-006 2001-006 Puerto Rico 2001 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16GE, E35ED, M36MI, N37NS, R41RK, R57RK, H69N, K70R, L89M, F99X  
>2001-006| codons 14-99
KIEGQLKEALLDTGADDTVLEDISLPGKWKPKMIGGIGGFIKVKQYDQILIEICGNRAIG
TVLVGPTPVNIIGRNMLTQIGCTLNL

References
Author Title Citation
Lopez, P The genetic diversity and evolution of HIV-1 subtype B epidemic in Puerto Rico. Unpublished, 2016