<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2001-077 2001-077 Puerto Rico 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI+NNRTI+PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, V82T, I84IV, L90LM   N37S, L63P, I64V, I85V, I93L  
>2001-077| codons 14-99
KIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFVKVRQYDQIPVEICGHKAIG
TVLVGPTPTNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K49KR, R83K, D177N, I178IM, T200A, R211K  
>2001-077| codons 38-234
CTEMEKEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPNMVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYEL

References
Author Title Citation
Lopez, P The genetic diversity and evolution of HIV-1 subtype B epidemic in Puerto Rico. Unpublished, 2016